PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000282792
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 468aa    MW: 53698.3 Da    PI: 9.7587
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000282792genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.4e-16118167148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48 
                      r+rW++eEd ll  +vkq+G++ W++++++m+  + R +k+c +rw +yl
    MDP0000282792 118 RQRWSAEEDALLSAYVKQYGPREWNLVSQRMNtpLDRDAKSCLERWKNYL 167
                      89**********************************************97 PP

2Myb_DNA-binding37.55.7e-12173217147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
    MDP0000282792 173 KGSLTEEEQRLVICLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 217
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.23113167IPR017930Myb domain
SMARTSM007171.2E-13117169IPR001005SANT/Myb domain
SuperFamilySSF466899.17E-22118212IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-20120173IPR009057Homeodomain-like
CDDcd001673.65E-9120167No hitNo description
PfamPF139214.7E-14121182No hitNo description
PROSITE profilePS5129423.217168222IPR017930Myb domain
SMARTSM007172.2E-10172220IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-14174216IPR009057Homeodomain-like
CDDcd001672.87E-7177218No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MXRNAXEFKN LHLLNDRCNX MARNPYAVVL VIGRXLISXT KXTXSRFGEE EPNLAVELLV  60
ATYLVGGVNP LTRNYCKQEG ERIQEFRRGC VVDEVWFRRA LKQKCNGQLY LLLEMKERQR  120
WSAEEDALLS AYVKQYGPRE WNLVSQRMNT PLDRDAKSCL ERWKNYLKPG IKKGSLTEEE  180
QRLVICLQAK HGNKWKKIAA EVPGRTAKRL GKWWEVFKEK QQREQKNNKT ADPIVEGKYD  240
RILETFAEKL VKERAAPTYL MGTSNGAYLH TETSSPAPTI LPPWLSNSNV SSNVRPPSPS  300
VTLSLSSAVA PSPPIPWLQQ DRGSDXSFVF GNLPHHGVVP ASGENLVISE LLECSRELEE  360
VHRAWAAHKK EASWRLRRVE LQLDSEKASR RREKMEEIET KVKALREEQN AALDRIEAEY  420
REQLAGLRRD AEAKEQKLAD QWAAKHSRLS KFLEQMGGRP MIAEPNGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-16121206789MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-16121206789C-Myb DNA-Binding Domain
1msf_C6e-16121206789C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.137890.0bud| fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744730.0DQ074473.1 Malus x domestica MYB91 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008387764.10.0PREDICTED: transcription factor AS1-like
SwissprotO809311e-155AS1_ARATH; Transcription factor AS1
TrEMBLQ2LMD90.0Q2LMD9_MALDO; MYB91
STRINGPOPTR_0006s08610.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25973369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-127MYB family protein